DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11857 and rer-1

DIOPT Version :9

Sequence 1:NP_001303417.1 Gene:CG11857 / 43042 FlyBaseID:FBgn0039303 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001366730.1 Gene:rer-1 / 174410 WormBaseID:WBGene00009783 Length:191 Species:Caenorhabditis elegans


Alignment Length:174 Identity:107/174 - (61%)
Similarity:129/174 - (74%) Gaps:7/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GGVKKFFQRLSQTYQSALDRSTPHTRMRWVFAGFLLLLFVLRIFIYQGWYIVCYALGIYHLNLFI 76
            |...:||..|...||..|||.||||..|||.|...|:.|..||.:.||:|||.||:|||:||||:
 Worm    10 GVTSRFFHSLEVKYQYYLDRLTPHTAFRWVIALISLVFFASRIILLQGFYIVAYAVGIYYLNLFL 74

  Fly    77 AFLTPKIDP--EFDPYSQDDEDEGPNLPTRSNEEFRPFIRRLPEFKFWLSVAKSTLIGLICTFFD 139
            .||||.|||  ||     :|||:||.||:::|:|||||:|||||||||.|..|:|||.:.||||:
 Worm    75 LFLTPSIDPALEF-----EDEDDGPVLPSKTNDEFRPFMRRLPEFKFWHSFMKATLIAITCTFFE 134

  Fly   140 FFNVPVFWPILVMYFITLFCITMKRQIKHMIKYKYLPFTRNKPR 183
            ||:||||||||||||..|..:|:||||.|||||:|:|||..|||
 Worm   135 FFDVPVFWPILVMYFFILTFLTLKRQIMHMIKYRYIPFTVGKPR 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11857NP_001303417.1 Rer1 17..185 CDD:281266 106/169 (63%)
rer-1NP_001366730.1 Rer1 14..178 CDD:397380 104/168 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158878
Domainoid 1 1.000 217 1.000 Domainoid score I1539
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5468
Inparanoid 1 1.050 222 1.000 Inparanoid score I2265
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54010
OrthoDB 1 1.010 - - D1458086at2759
OrthoFinder 1 1.000 - - FOG0003808
OrthoInspector 1 1.000 - - oto19507
orthoMCL 1 0.900 - - OOG6_101272
Panther 1 1.100 - - LDO PTHR10743
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1080
SonicParanoid 1 1.000 - - X2191
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.