DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup358 and AT1G52380

DIOPT Version :9

Sequence 1:NP_001247302.1 Gene:Nup358 / 43041 FlyBaseID:FBgn0039302 Length:2718 Species:Drosophila melanogaster
Sequence 2:NP_001322286.1 Gene:AT1G52380 / 841668 AraportID:AT1G52380 Length:440 Species:Arabidopsis thaliana


Alignment Length:392 Identity:91/392 - (23%)
Similarity:146/392 - (37%) Gaps:95/392 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1152 PQVAPSVPAQP-------PAPAPVSVPSMFNRALNNQPVEKEPPANVVITSSDPLPKPTTASVQP 1209
            |..||...:.|       |..||.|.|...|..|..   .|..||..|:..:.     ..:.::.
plant    62 PSAAPVAASNPFAGIQLVPTTAPASTPVGTNAPLAE---SKLAPAEAVVEDNQ-----KASDIEE 118

  Fly  1210 TLSVTIPAQHIKPSLVQAPEQ----------PAQSAQPAQPSVSGVGSLSFNF------GSKSSE 1258
            ...|......:|.::.:..|:          .:...|.|...|:.:.|...|.      |:..::
plant   119 GDEVDSKKVDVKDAVGEETEKTKDKDDNHCGKSADVQVAATEVAQMVSCDTNVCNNAVEGTDQTD 183

  Fly  1259 SPFSFKTQVAKAAAEKQKEQ---EEAEQN------------------------------------ 1284
            .|.. |......|.:|:||.   |||::|                                    
plant   184 FPLE-KDSGGDQAEKKEKEGNGIEEADKNGDNGAFSSFQQHSSNKNAFTGLASTEASGSSFSFGL 247

  Fly  1285 --QSGATDPNKT----LPQDTSADDYDPRPDFKPII--------PLPDEVEVRTGEEGEDIKFTS 1335
              |.|:|.....    ||...|:..:....  ..||        |...||...||||.|.:.|::
plant   248 VSQDGSTGTGSLFGFGLPSSNSSSIFGATG--SSIIKKSEGSGFPPKQEVSTETGEENEKVAFSA 310

  Fly  1336 RAKLFRYVDKEWKERGTGVIKILCDKATGVSRVLMRRDQTHKVCANHTITADITINVANQDKDKK 1400
            .:.:|.|:|..|||||.|.:|:......|.:|::||....:::..|.::..:  :.:||.  |||
plant   311 DSIMFEYLDGGWKERGKGELKVNVSSNDGKARLVMRAKGNYRLILNASLYPE--MKLANM--DKK 371

  Fly  1401 SLLWA-ANDFADEQVTLERFLVRFKTGELAEEFRVAFTKASEA---AKSKETVKPTVNTAEKGST 1461
            .:.:| .|..::.:..|..|.::||...:.||||||..|..::   .|:.|.....:.|.|...|
plant   372 GITFACVNSVSEGKEGLSTFALKFKDPTIVEEFRVAIDKHKDSKPMEKAAEKSALPLKTPENSPT 436

  Fly  1462 AT 1463
            ||
plant   437 AT 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup358NP_001247302.1 TPR <14..128 CDD:223533
TPR repeat 58..90 CDD:276809
Atrophin-1 <1030..1308 CDD:331285 40/223 (18%)
RanBD1_RanBP2_insect-like 1324..1442 CDD:269992 39/118 (33%)
RanBD2_RanBP2_insect-like 1620..1737 CDD:269993
RanBP2-type Zn finger 1774..1793 CDD:275376
Nucleoporin_FG2 1806..>1986 CDD:330420
RanBP2-type Zn finger 1833..1861 CDD:275375
zf-RanBP 1891..1917 CDD:279035
RanBP2-type Zn finger 1894..1913 CDD:275376
RanBD3_RanBP2_insect-like 2034..2148 CDD:269994
RanBD4_RanBP2_insect-like 2571..2694 CDD:269995
AT1G52380NP_001322286.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23138
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.