DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup358 and SIRANBP

DIOPT Version :9

Sequence 1:NP_001247302.1 Gene:Nup358 / 43041 FlyBaseID:FBgn0039302 Length:2718 Species:Drosophila melanogaster
Sequence 2:NP_172194.1 Gene:SIRANBP / 837225 AraportID:AT1G07140 Length:228 Species:Arabidopsis thaliana


Alignment Length:247 Identity:80/247 - (32%)
Similarity:125/247 - (50%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1272 AEKQKEQEEAEQNQSGATDPNKTLPQDTSADDYDPRPDFKPIIPLPDEVEVRTGEEGEDIKFTSR 1336
            |..:.|.|..::.::||.:     .:||.|       ...||:.| :||.|.||||.||.....:
plant     2 ATNEPEHEHRDEEEAGANE-----DEDTGA-------QVAPIVRL-EEVAVTTGEEDEDAVLDLK 53

  Fly  1337 AKLFRYVDK---EWKERGTGVIKILCDKATGVSRVLMRRDQTHKVCANHTITADITI--NVANQD 1396
            :||:|: ||   :|||||.|.:|.|..|.||..|::||:.:|.|:||||.:.:.:::  :|.|: 
plant    54 SKLYRF-DKDANQWKERGAGTVKFLKHKNTGKIRLVMRQSKTLKICANHFVKSGMSVQEHVGNE- 116

  Fly  1397 KDKKSLLWAANDFADEQVTLERFLVRFKTGELAEEFRVAFTKASEAAKSKETVKPTVNTA----- 1456
               ||.:|.|.||||.::..|.|.:||.:.|..:.|...|.:.:|:.:.||..|...:||     
plant   117 ---KSCVWHARDFADGELKDELFCIRFASIENCKTFMQKFKEVAESEEEKEESKDAADTAGLLEK 178

  Fly  1457 --------EKGSTATAPAAFKSFVTSTPAANSLINKPQEQTKTQPNPDPPAT 1500
                    |:.:.|.|....|:.|.:.....|...|..|..||:.:  .|:|
plant   179 LTVEETKTEEKTEAKAVETAKTEVKAEEKKESEAEKSGEAKKTEES--GPST 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup358NP_001247302.1 TPR <14..128 CDD:223533
TPR repeat 58..90 CDD:276809
Atrophin-1 <1030..1308 CDD:331285 8/35 (23%)
RanBD1_RanBP2_insect-like 1324..1442 CDD:269992 48/122 (39%)
RanBD2_RanBP2_insect-like 1620..1737 CDD:269993
RanBP2-type Zn finger 1774..1793 CDD:275376
Nucleoporin_FG2 1806..>1986 CDD:330420
RanBP2-type Zn finger 1833..1861 CDD:275375
zf-RanBP 1891..1917 CDD:279035
RanBP2-type Zn finger 1894..1913 CDD:275376
RanBD3_RanBP2_insect-like 2034..2148 CDD:269994
RanBD4_RanBP2_insect-like 2571..2694 CDD:269995
SIRANBPNP_172194.1 RanBD_RanBP1 25..155 CDD:270000 55/142 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2578
eggNOG 1 0.900 - - E1_COG5171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000925
OrthoInspector 1 1.000 - - otm3122
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23138
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.