DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup358 and RANBP1

DIOPT Version :9

Sequence 1:NP_001247302.1 Gene:Nup358 / 43041 FlyBaseID:FBgn0039302 Length:2718 Species:Drosophila melanogaster
Sequence 2:NP_001265568.1 Gene:RANBP1 / 5902 HGNCID:9847 Length:278 Species:Homo sapiens


Alignment Length:209 Identity:71/209 - (33%)
Similarity:111/209 - (53%) Gaps:29/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  2002 EDEDNDSQEVEEEENNTYFSPVIPLPDKIDVKTGEEDEELLYVHKAKLYRL-NESD---WKERGL 2062
            ||.|..::..:|..::..|.|::.||:: ::||.|||||.|:..:|||:|. :|:|   |||||.
Human    86 EDHDTSTENTDESNHDPQFEPIVSLPEQ-EIKTLEEDEEELFKMRAKLFRFASENDLPEWKERGT 149

  Fly  2063 GDVKILRHRQTKKLRVVMRREQVFKICLNHVLNENVVYREK--TETSWMFAVH-DFSEGESVLER 2124
            ||||:|:|::...:|::|||::..|||.||.:...:..:..  ::.:|::..| ||::.....|.
Human   150 GDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADECPKPEL 214

  Fly  2125 FTLRFKNKEVAQGFMEAIKNALNETAKPIEDSPVVGSVSQSTEANKPSQKNDGAAKSRGGESEVL 2189
            ..:||.|.|.||.|    |....|..|.||:          .|....|.|||.|.|       |.
Human   215 LAIRFLNAENAQKF----KTKFEECRKEIEE----------REKKAGSGKNDHAEK-------VA 258

  Fly  2190 DVGKTSSVRPTTHE 2203
            :..:..||:..|.|
Human   259 EKLEALSVKEETKE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup358NP_001247302.1 TPR <14..128 CDD:223533
TPR repeat 58..90 CDD:276809
Atrophin-1 <1030..1308 CDD:331285
RanBD1_RanBP2_insect-like 1324..1442 CDD:269992
RanBD2_RanBP2_insect-like 1620..1737 CDD:269993
RanBP2-type Zn finger 1774..1793 CDD:275376
Nucleoporin_FG2 1806..>1986 CDD:330420
RanBP2-type Zn finger 1833..1861 CDD:275375
zf-RanBP 1891..1917 CDD:279035
RanBP2-type Zn finger 1894..1913 CDD:275376
RanBD3_RanBP2_insect-like 2034..2148 CDD:269994 46/120 (38%)
RanBD4_RanBP2_insect-like 2571..2694 CDD:269995
RANBP1NP_001265568.1 RanBD_RanBP1 101..237 CDD:270000 52/140 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159286
Domainoid 1 1.000 105 1.000 Domainoid score I6642
eggNOG 1 0.900 - - E1_COG5171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.664386 Normalized mean entropy S1079
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000925
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3834
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.