Sequence 1: | NP_001247302.1 | Gene: | Nup358 / 43041 | FlyBaseID: | FBgn0039302 | Length: | 2718 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265568.1 | Gene: | RANBP1 / 5902 | HGNCID: | 9847 | Length: | 278 | Species: | Homo sapiens |
Alignment Length: | 209 | Identity: | 71/209 - (33%) |
---|---|---|---|
Similarity: | 111/209 - (53%) | Gaps: | 29/209 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 2002 EDEDNDSQEVEEEENNTYFSPVIPLPDKIDVKTGEEDEELLYVHKAKLYRL-NESD---WKERGL 2062
Fly 2063 GDVKILRHRQTKKLRVVMRREQVFKICLNHVLNENVVYREK--TETSWMFAVH-DFSEGESVLER 2124
Fly 2125 FTLRFKNKEVAQGFMEAIKNALNETAKPIEDSPVVGSVSQSTEANKPSQKNDGAAKSRGGESEVL 2189
Fly 2190 DVGKTSSVRPTTHE 2203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nup358 | NP_001247302.1 | TPR | <14..128 | CDD:223533 | |
TPR repeat | 58..90 | CDD:276809 | |||
Atrophin-1 | <1030..1308 | CDD:331285 | |||
RanBD1_RanBP2_insect-like | 1324..1442 | CDD:269992 | |||
RanBD2_RanBP2_insect-like | 1620..1737 | CDD:269993 | |||
RanBP2-type Zn finger | 1774..1793 | CDD:275376 | |||
Nucleoporin_FG2 | 1806..>1986 | CDD:330420 | |||
RanBP2-type Zn finger | 1833..1861 | CDD:275375 | |||
zf-RanBP | 1891..1917 | CDD:279035 | |||
RanBP2-type Zn finger | 1894..1913 | CDD:275376 | |||
RanBD3_RanBP2_insect-like | 2034..2148 | CDD:269994 | 46/120 (38%) | ||
RanBD4_RanBP2_insect-like | 2571..2694 | CDD:269995 | |||
RANBP1 | NP_001265568.1 | RanBD_RanBP1 | 101..237 | CDD:270000 | 52/140 (37%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165159286 | |
Domainoid | 1 | 1.000 | 105 | 1.000 | Domainoid score | I6642 |
eggNOG | 1 | 0.900 | - | - | E1_COG5171 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0.664386 | Normalized mean entropy | S1079 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000925 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3834 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.720 |