DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup358 and RanBP3

DIOPT Version :9

Sequence 1:NP_001247302.1 Gene:Nup358 / 43041 FlyBaseID:FBgn0039302 Length:2718 Species:Drosophila melanogaster
Sequence 2:NP_651178.1 Gene:RanBP3 / 42804 FlyBaseID:FBgn0039110 Length:449 Species:Drosophila melanogaster


Alignment Length:458 Identity:105/458 - (22%)
Similarity:166/458 - (36%) Gaps:105/458 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1127 TAPAPPIAGTVNPPATTAVPPPVHIPQVAPSVPAQPPAPAPVSVPSMFNRALNNQPVEKE----- 1186
            |..|..:.|.|..||..|.....:....:||...              :.||.|.|..:|     
  Fly    19 TLKASRLGGAVLRPAVLANSSGSNNSSTSPSAGE--------------DSALLNNPFLRESKDDD 69

  Fly  1187 PPANVVITSS------------------DPLPKPTTASVQPTLSVTIPAQHIKPSL--------- 1224
            ....||.|.|                  |||.|..:..::.: |:...|::..|::         
  Fly    70 DDEEVVATGSAAAESTGDKEDDDVDERPDPLTKLRSNGIERS-SMFAAAKNNMPNVQSSGFVFGQ 133

  Fly  1225 -----VQAPEQPAQSAQP----AQPSVSGVGSLSFNFGSKSSESPFSFKTQVAKAAAEKQKEQEE 1280
                 |.||.....:|:|    |..|||...:.|.:..:.||.:|..|.:.:..||...:..:..
  Fly   134 NVHERVVAPNAEQVTAEPDADTAASSVSAQEAASSSTAATSSSAPLLFSSVIQNAAQTTETSEAA 198

  Fly  1281 AEQNQSGATDPNKTLPQDTSADDY-----DPRPDFKPIIPLPDEVEVRTGEEGEDIKFTSRAKLF 1340
            |..:...::..||...:..|..|.     :.|...:..    :|||..||||.|........|||
  Fly   199 ASSSICSSSSNNKESAEAKSLTDVAREYEESRAQKRKY----EEVETFTGEEDEINIIDVSCKLF 259

  Fly  1341 RYVDKEWKERGTGVIKILCDK-ATGVSRVLMRRDQTHKVCANHTITADITINVANQDKDKKSLLW 1404
            .:::..|:|||.|.:::...| ..|.|||:.|.....::..|..:.|.:....|:|    |||..
  Fly   260 AFLNSNWEERGRGSLRLNDAKDLRGDSRVVFRTSGNLRLLLNTKVWAAMVAERASQ----KSLRL 320

  Fly  1405 AANDFADEQVTLERFLVRFKTGELAEEFRVAFTKASEAAKSKETVKPTVNTAEKGSTATAPAAFK 1469
            .|   .|....::.||...:..::|:..:         |.|:...|..|:..|:.|...|    |
  Fly   321 TA---IDNSGVVKIFLAMGRPADIAQLHK---------ALSERIAKRKVSHPEECSVEEA----K 369

  Fly  1470 SFVTSTPAANSLINKPQEQTKTQPNPDPPATAAKSLFGTLSVSA------------APATSAPAS 1522
            :.|.|..||:.     |.::.|..:.|..|....|  |.:|..|            .|.:||...
  Fly   370 NGVASEAAASL-----QPESTTHDDEDEDAAPGPS--GAISAEADSYGPSPKKVIVQPDSSADVP 427

  Fly  1523 ATP 1525
            ..|
  Fly   428 VPP 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup358NP_001247302.1 TPR <14..128 CDD:223533
TPR repeat 58..90 CDD:276809
Atrophin-1 <1030..1308 CDD:331285 46/226 (20%)
RanBD1_RanBP2_insect-like 1324..1442 CDD:269992 31/118 (26%)
RanBD2_RanBP2_insect-like 1620..1737 CDD:269993
RanBP2-type Zn finger 1774..1793 CDD:275376
Nucleoporin_FG2 1806..>1986 CDD:330420
RanBP2-type Zn finger 1833..1861 CDD:275375
zf-RanBP 1891..1917 CDD:279035
RanBP2-type Zn finger 1894..1913 CDD:275376
RanBD3_RanBP2_insect-like 2034..2148 CDD:269994
RanBD4_RanBP2_insect-like 2571..2694 CDD:269995
RanBP3NP_651178.1 RanBD_RanBP3 243..352 CDD:270001 33/124 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23138
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.