| Sequence 1: | NP_001247302.1 | Gene: | Nup358 / 43041 | FlyBaseID: | FBgn0039302 | Length: | 2718 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_989020.1 | Gene: | ranbp1 / 394616 | XenbaseID: | XB-GENE-490910 | Length: | 209 | Species: | Xenopus tropicalis |
| Alignment Length: | 197 | Identity: | 74/197 - (37%) |
|---|---|---|---|
| Similarity: | 105/197 - (53%) | Gaps: | 30/197 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1272 AEKQKEQEEAEQNQSGATDPNKTLPQDTSADDYDPRPDFKPIIPLPDEVEVRTGEEGEDIKFTSR 1336
Fly 1337 AKLFRYVDK----EWKERGTGVIKILCDKATGVSRVLMRRDQTHKVCANHTITADITINVANQDK 1397
Fly 1398 DKKSLLWAAN---DFADEQVTLERFLVRFKTGELAEEFRVAFTKAS---EAAKSKETVKPTVNTA 1456
Fly 1457 EK 1458 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Nup358 | NP_001247302.1 | TPR | <14..128 | CDD:223533 | |
| TPR repeat | 58..90 | CDD:276809 | |||
| Atrophin-1 | <1030..1308 | CDD:331285 | 9/35 (26%) | ||
| RanBD1_RanBP2_insect-like | 1324..1442 | CDD:269992 | 53/127 (42%) | ||
| RanBD2_RanBP2_insect-like | 1620..1737 | CDD:269993 | |||
| RanBP2-type Zn finger | 1774..1793 | CDD:275376 | |||
| Nucleoporin_FG2 | 1806..>1986 | CDD:330420 | |||
| RanBP2-type Zn finger | 1833..1861 | CDD:275375 | |||
| zf-RanBP | 1891..1917 | CDD:279035 | |||
| RanBP2-type Zn finger | 1894..1913 | CDD:275376 | |||
| RanBD3_RanBP2_insect-like | 2034..2148 | CDD:269994 | |||
| RanBD4_RanBP2_insect-like | 2571..2694 | CDD:269995 | |||
| ranbp1 | NP_989020.1 | RanBD_RanBP1 | 24..159 | CDD:270000 | 61/141 (43%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 110 | 1.000 | Domainoid score | I6208 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000925 | |
| OrthoInspector | 1 | 1.000 | - | - | otm48049 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.910 | |||||