DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup358 and Ranbp1

DIOPT Version :9

Sequence 1:NP_001247302.1 Gene:Nup358 / 43041 FlyBaseID:FBgn0039302 Length:2718 Species:Drosophila melanogaster
Sequence 2:NP_001101794.1 Gene:Ranbp1 / 360739 RGDID:1310521 Length:203 Species:Rattus norvegicus


Alignment Length:192 Identity:69/192 - (35%)
Similarity:105/192 - (54%) Gaps:26/192 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1999 AAK---EDEDNDSQEVEEEENNTYFSPVIPLPDKIDVKTGEEDEELLYVHKAKLYRL-NESD--- 2056
            |||   ||.|..::..||..::..|.|::.||:: ::||.|||||.|:..:|||:|. :|:|   
  Rat     3 AAKDSHEDHDTSTENAEESNHDPQFEPIVSLPEQ-EIKTLEEDEEELFKMRAKLFRFASENDLPE 66

  Fly  2057 WKERGLGDVKILRHRQTKKLRVVMRREQVFKICLNHVLNENVVYREK--TETSWMFAVH-DFSEG 2118
            |||||.||||:|:|::...:|::|||::..|||.||.:...:..:..  ::.:|::..| ||::.
  Rat    67 WKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADE 131

  Fly  2119 ESVLERFTLRFKNKEVAQGFMEAIKNALNETAKPIEDSPVVGSVSQSTEANKPSQKNDGAAK 2180
            ....|...:||.|.|.||.|    |....|..|.||:           ...|...|||.|.|
  Rat   132 CPKPELLAIRFLNAENAQKF----KTKFEECRKEIEE-----------REKKGPGKNDNAEK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup358NP_001247302.1 TPR <14..128 CDD:223533
TPR repeat 58..90 CDD:276809
Atrophin-1 <1030..1308 CDD:331285
RanBD1_RanBP2_insect-like 1324..1442 CDD:269992
RanBD2_RanBP2_insect-like 1620..1737 CDD:269993
RanBP2-type Zn finger 1774..1793 CDD:275376
Nucleoporin_FG2 1806..>1986 CDD:330420
RanBP2-type Zn finger 1833..1861 CDD:275375
zf-RanBP 1891..1917 CDD:279035
RanBP2-type Zn finger 1894..1913 CDD:275376
RanBD3_RanBP2_insect-like 2034..2148 CDD:269994 46/120 (38%)
RanBD4_RanBP2_insect-like 2571..2694 CDD:269995
Ranbp1NP_001101794.1 RanBD_RanBP1 24..160 CDD:270000 52/140 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353307
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000925
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.