DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and RPS27A

DIOPT Version :9

Sequence 1:NP_001247301.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_012766.1 Gene:RPS27A / 853700 SGDID:S000001639 Length:82 Species:Saccharomyces cerevisiae


Alignment Length:82 Identity:59/82 - (71%)
Similarity:64/82 - (78%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQ 65
            |.|.:|||||..|.|.||||||.|||.|.|||:|||||||..|||||||||..|.|..|:||||.
Yeast     1 MVLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCESCSTILCT 65

  Fly    66 PTGGRAKLTEGCSFRRK 82
            ||||:|||:||.|||||
Yeast    66 PTGGKAKLSEGTSFRRK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_001247301.1 PTZ00083 6..83 CDD:185434 57/77 (74%)
RPS27ANP_012766.1 Ribosomal_S27e 5..82 CDD:294584 55/76 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346636
Domainoid 1 1.000 94 1.000 Domainoid score I1678
eggNOG 1 0.900 - - E1_COG2051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H803
Inparanoid 1 1.050 127 1.000 Inparanoid score I1270
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53676
OrthoFinder 1 1.000 - - FOG0001154
OrthoInspector 1 1.000 - - otm46780
orthoMCL 1 0.900 - - OOG6_100584
Panther 1 1.100 - - O PTHR11594
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1242
SonicParanoid 1 1.000 - - X705
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.