DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and AT5G47930

DIOPT Version :9

Sequence 1:NP_001247301.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_199604.1 Gene:AT5G47930 / 834844 AraportID:AT5G47930 Length:84 Species:Arabidopsis thaliana


Alignment Length:77 Identity:59/77 - (76%)
Similarity:66/77 - (85%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQPTGGR 70
            |||||.|..||||||||||||.|||:||||||.||:.|||||||:|.||||..|.|:|||||||:
plant     8 DLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGK 72

  Fly    71 AKLTEGCSFRRK 82
            |:|.||||||:|
plant    73 ARLQEGCSFRKK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_001247301.1 PTZ00083 6..83 CDD:185434 59/77 (77%)
AT5G47930NP_199604.1 PLN00209 1..84 CDD:165774 58/75 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2224
eggNOG 1 0.900 - - E1_COG2051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H803
Inparanoid 1 1.050 133 1.000 Inparanoid score I1852
OMA 1 1.010 - - QHG53676
OrthoDB 1 1.010 - - D1537724at2759
OrthoFinder 1 1.000 - - FOG0001154
OrthoInspector 1 1.000 - - otm2781
orthoMCL 1 0.900 - - OOG6_100584
Panther 1 1.100 - - LDO PTHR11594
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X705
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.