DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and Rps27l

DIOPT Version :10

Sequence 1:NP_651359.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_063122200.1 Gene:Rps27l / 681429 RGDID:1595396 Length:96 Species:Rattus norvegicus


Alignment Length:79 Identity:63/79 - (79%)
Similarity:71/79 - (89%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQ 65
            ||||:|||||...|||:|||.|||||.||||||||||||||:|||||||||.||:|.||:|:|||
  Rat     1 MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQ 65

  Fly    66 PTGGRAKLTEGCSF 79
            ||||:|:||||.||
  Rat    66 PTGGKARLTEGISF 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_651359.1 PTZ00083 6..83 CDD:185434 59/74 (80%)
Rps27lXP_063122200.1 None

Return to query results.
Submit another query.