DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and Rps27l

DIOPT Version :10

Sequence 1:NP_651359.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001298030.1 Gene:Rps27l / 67941 MGIID:1915191 Length:105 Species:Mus musculus


Alignment Length:80 Identity:62/80 - (77%)
Similarity:70/80 - (87%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQ 65
            ||||:|||||...|||:|||.|||||.||||||||||||||:|||||||||.||:|.||:|:|||
Mouse     1 MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQ 65

  Fly    66 PTGGRAKLT-EGCSF 79
            ||||:|:|| |.|.|
Mouse    66 PTGGKARLTEESCEF 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_651359.1 PTZ00083 6..83 CDD:185434 58/75 (77%)
Rps27lNP_001298030.1 Ribosomal_S27e 6..80 CDD:445165 57/73 (78%)

Return to query results.
Submit another query.