DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and Rps27l

DIOPT Version :9

Sequence 1:NP_001247301.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001298030.1 Gene:Rps27l / 67941 MGIID:1915191 Length:105 Species:Mus musculus


Alignment Length:80 Identity:62/80 - (77%)
Similarity:70/80 - (87%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQ 65
            ||||:|||||...|||:|||.|||||.||||||||||||||:|||||||||.||:|.||:|:|||
Mouse     1 MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQ 65

  Fly    66 PTGGRAKLT-EGCSF 79
            ||||:|:|| |.|.|
Mouse    66 PTGGKARLTEESCEF 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_001247301.1 PTZ00083 6..83 CDD:185434 58/75 (77%)
Rps27lNP_001298030.1 Ribosomal_S27e 6..80 CDD:294584 57/73 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6193
eggNOG 1 0.900 - - E1_COG2051
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4262
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53676
OrthoDB 1 1.010 - - D1537724at2759
OrthoFinder 1 1.000 - - FOG0001154
OrthoInspector 1 1.000 - - otm43300
orthoMCL 1 0.900 - - OOG6_100584
Panther 1 1.100 - - LDO PTHR11594
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X705
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.