DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and rps27l

DIOPT Version :9

Sequence 1:NP_001247301.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001166151.1 Gene:rps27l / 677743 ZFINID:ZDB-GENE-060331-65 Length:84 Species:Danio rerio


Alignment Length:82 Identity:62/82 - (75%)
Similarity:74/82 - (90%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQ 65
            |||::||::|....|:|:||.|||||.||||||||||||||:|||||||||.||:|.||:|:|||
Zfish     1 MPLSRDLINPSFDLERRQHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQ 65

  Fly    66 PTGGRAKLTEGCSFRRK 82
            ||||:|:||||||||||
Zfish    66 PTGGKARLTEGCSFRRK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_001247301.1 PTZ00083 6..83 CDD:185434 59/77 (77%)
rps27lNP_001166151.1 PLN00209 6..82 CDD:165774 57/75 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6134
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4256
OMA 1 1.010 - - QHG53676
OrthoDB 1 1.010 - - D1537724at2759
OrthoFinder 1 1.000 - - FOG0001154
OrthoInspector 1 1.000 - - otm26391
orthoMCL 1 0.900 - - OOG6_100584
Panther 1 1.100 - - LDO PTHR11594
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X705
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.