DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and Rps27

DIOPT Version :10

Sequence 1:NP_651359.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_081291.1 Gene:Rps27 / 57294 MGIID:1888676 Length:84 Species:Mus musculus


Alignment Length:82 Identity:70/82 - (85%)
Similarity:76/82 - (92%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQ 65
            ||||||||||.|.|||||||.|||||.||||||||||||||:|||||||||.||:|.||:|:|||
Mouse     1 MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQ 65

  Fly    66 PTGGRAKLTEGCSFRRK 82
            ||||:|:||||||||||
Mouse    66 PTGGKARLTEGCSFRRK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_651359.1 PTZ00083 6..83 CDD:185434 65/77 (84%)
Rps27NP_081291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 18/21 (86%)
PLN00209 6..82 CDD:165774 63/75 (84%)

Return to query results.
Submit another query.