DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and rps27

DIOPT Version :9

Sequence 1:NP_001247301.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_595214.1 Gene:rps27 / 2539969 PomBaseID:SPBC1685.10 Length:83 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:59/82 - (71%)
Similarity:68/82 - (82%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQ 65
            |.||.|||:|....|.||||||:|||.|.|:|||||||||:.|||||||||.||:|..||::|||
pombe     1 MVLAVDLLNPSHESEMRKHKLKQLVQGPRSFFMDVKCPGCFNITTVFSHAQTVVICGSCASVLCQ 65

  Fly    66 PTGGRAKLTEGCSFRRK 82
            ||||:|:|.||||||||
pombe    66 PTGGKARLMEGCSFRRK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_001247301.1 PTZ00083 6..83 CDD:185434 56/77 (73%)
rps27NP_595214.1 PLN00209 1..82 CDD:165774 57/80 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I1760
eggNOG 1 0.900 - - E1_COG2051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H803
Inparanoid 1 1.050 130 1.000 Inparanoid score I1429
OMA 1 1.010 - - QHG53676
OrthoFinder 1 1.000 - - FOG0001154
OrthoInspector 1 1.000 - - oto101175
orthoMCL 1 0.900 - - OOG6_100584
Panther 1 1.100 - - LDO PTHR11594
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1242
SonicParanoid 1 1.000 - - X705
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.