DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and LOC108349071

DIOPT Version :9

Sequence 1:NP_001247301.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_017445358.1 Gene:LOC108349071 / 108349071 RGDID:11496872 Length:84 Species:Rattus norvegicus


Alignment Length:82 Identity:48/82 - (58%)
Similarity:60/82 - (73%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQ 65
            |...|||||..|.||:.|||...|||.||||.:::||||.|:|||||||.|.||:..||:::|||
  Rat     1 MCFTKDLLHTSPEEERWKHKKNHLVQSPNSYLVNMKCPGYYKITTVFSHTQMVVLGVGCSSVLCQ 65

  Fly    66 PTGGRAKLTEGCSFRRK 82
            |..|:|:.||.|.||:|
  Rat    66 PPAGKARQTEECLFRKK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_001247301.1 PTZ00083 6..83 CDD:185434 46/77 (60%)
LOC108349071XP_017445358.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537724at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.