DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27 and LOC102548794

DIOPT Version :10

Sequence 1:NP_651359.1 Gene:RpS27 / 43039 FlyBaseID:FBgn0039300 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_006249044.1 Gene:LOC102548794 / 102548794 RGDID:7536442 Length:87 Species:Rattus norvegicus


Alignment Length:81 Identity:61/81 - (75%)
Similarity:67/81 - (82%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHAQGVVVCAGCATILCQP 66
            |||:|||||.|.|||||||.|.|||.|||||||||..|||:|  |||.||.||.||||:.:||||
  Rat     7 PLAEDLLHPSPEEEKRKHKKKHLVQSPNSYFMDVKWLGCYKI--VFSQAQTVVGCAGCSIVLCQP 69

  Fly    67 TGGRAKLTEGCSFRRK 82
            |||:|:|.||||||||
  Rat    70 TGGKARLIEGCSFRRK 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27NP_651359.1 PTZ00083 6..83 CDD:185434 58/77 (75%)
LOC102548794XP_006249044.1 Ribosomal_S27e 11..85 CDD:445165 56/75 (75%)

Return to query results.
Submit another query.