DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG14259

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:228 Identity:63/228 - (27%)
Similarity:111/228 - (48%) Gaps:22/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FPSGIERCAIMDEQCLEDRVNFVLRNYAKSGIKEL----GLIPLDPLHVKK--FKIGRNPHSPVN 81
            :..|..:|:....|.|.|::|.        ||.|:    |  |.||:.|:.  ||...|..:.:.
  Fly    52 YEPGFTKCSTNSIQKLLDQLNI--------GIPEVLERFG--PFDPMRVRDIVFKQDNNEVATIR 106

  Fly    82 IDLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVMEVPEIGVRGPYSVDGRILILPITGNGIAD 146
            .:|:  ::.:.|......|......:|.|...::.:  |::.:.|.|.:.||||::|::|:|...
  Fly   107 ANLT--DLVVKGFANTKVKESRVSKKDFSWQTKIYL--PKMRLDGRYEMAGRILLIPLSGSGKIF 167

  Fly   147 IRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQ-KDLSENMHALINE 210
            |.:....:....|::...||.. |:..|..::|:|:.|.|...|:|||||: |::..:.:...||
  Fly   168 IEIDDLDILLLTKIRLYEKGGF-TFDNVTAVQVQLNLSKVRTYLDNLFNGRSKEVERSTNEFFNE 231

  Fly   211 NWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLP 243
            ||:|.:..|||.|.|....|...|:..:|..:|
  Fly   232 NWRDFYEALKPLIVETVENILYDVMSTVFHLIP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 63/228 (28%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 63/228 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.