DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG14258

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster


Alignment Length:253 Identity:61/253 - (24%)
Similarity:111/253 - (43%) Gaps:16/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTLALVLLFGCASTYG--HASDFPSGIERCAIMDEQ---CLEDRVNFVLRNYAKSGIKELGLI-P 61
            |::..|||   ::..|  :.::.|..:..|.:.|..   ||........|.: |.||.....: .
  Fly     9 LSIVAVLL---SAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQW-KDGIPGYNAVGS 69

  Fly    62 LDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRSI-ELVMEVPEIGVR 125
            .||.::|:.|..::....:.|:....|:.:.|..|.:....|.   |.:..: ..::.||::...
  Fly    70 FDPFYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSW---DPNHYVARTLISVPKLRFN 131

  Fly   126 GPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVEL-DPSHVTYQ 189
            ..|.|.|.:..|.:.|:|..........:..::.:|.::..|.. :|:|.::||.. :......:
  Fly   132 FDYKVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGY-FADVQSVKVNFREIKQFRIK 195

  Fly   190 LENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQL 247
            |||||.|.|||.:..|.|.||||:|.|..|:|.:.:..|.:......:.|..:|...|
  Fly   196 LENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYVPATYL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 56/233 (24%)
CG14258NP_651531.1 JHBP 13..255 CDD:284096 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.