DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG15497

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster


Alignment Length:269 Identity:60/269 - (22%)
Similarity:99/269 - (36%) Gaps:54/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLLFGCASTYGHASDFPSGIE----------RCAIMDE---QCLEDRVNFVLRNYAKSGIKELG 58
            ||.|.|.:....|.::..|.|:          ||...||   :|:....| .||.|..:|:.:..
  Fly    13 LVYLAGISLFANHLANASSQIDVDTDLKHLLGRCHWSDEDFNECMRQVFN-DLRAYFTTGVPDYN 76

  Fly    59 LIPLDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAKRVS--GFTRD---------LSRS 112
            :.|.||.|....::.|.            |...||..:.:.:.||  |:.|.         ..:.
  Fly    77 IKPFDPHHCSYVELRRG------------ESQGLGSFRLILRNVSEYGWARSEVTKFHADPEDQR 129

  Fly   113 IELVMEVPEIGVRGPYSVDGRILILPITGNGIADIRL----TRTKVRAQIKLKRVSKGDHQTYAE 173
            |......|:..:.|.|....::|...:...|..::.|    ..|.||      |:...     ..
  Fly   130 IVYTQYFPDKSLEGEYEFAAKMLGTEMNRKGHWNLTLYDYSQTTSVR------RIGGP-----GS 183

  Fly   174 VMNIKVELDP-SHVTYQLENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDR 237
            ::.:.||:|. ..:...:|||..|| .|::....:||..|:.....:||.|.|........:.:.
  Fly   184 LIKVHVEVDRIGGMELHIENLLQGQ-PLNQLADGVINSMWQLGLPFIKPMINELVSTAFTDIFNE 247

  Fly   238 IFGKLPLEQ 246
            .|...|||:
  Fly   248 SFRHFPLEK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 55/255 (22%)
CG15497NP_650976.1 JHBP 26..258 CDD:284096 55/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.