DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG17279

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:245 Identity:70/245 - (28%)
Similarity:121/245 - (49%) Gaps:3/245 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LALVLLFGCASTYGHASDFPSGIERCAIMDEQCLEDRVNFVLRNYAKSGIKELGLIPLDPLHVKK 69
            :.|::...|..........|..||:|...|..|:.:.|..:||.|.| |:..:||:.||.:..:.
  Fly     1 MRLIVFVCCLWMAPSLGQLPPEIEKCRAGDSICIAETVTRILRLYPK-GLPSIGLVALDSIGFED 64

  Fly    70 FKIGR-NPHSPVNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVMEVPEIGVRGPYSVDGR 133
            ..:.| .|......||.|..:.::|..........||..||.|.:||...:|.:.:.|.|.:.|.
  Fly    65 VVVSRLEPDGSSTFDLKFPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMRGS 129

  Fly   134 ILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQK 198
            :|.:||.|.|.|.:.:...:||.::::....:.|.:.||.:..:|..||...:...|||||| ..
  Fly   130 LLTMPIHGKGQAKVEIRECRVRCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFN-NP 193

  Fly   199 DLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQLF 248
            ::|:.|:.:.|..|.:|::.|:.||..|...:.:|::.|:..|||.:.|:
  Fly   194 EMSDAMNVVANTKWLEIWHNLRRGITSAVDQLVESILQRVANKLPYDDLY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 68/229 (30%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 68/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101599at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.