DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG7079

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:124/262 - (47%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LALVL----LFG---CASTYGHASDFPSGIERCAIMDEQCLEDRVNFVLRNYAKSGIKELGLIPL 62
            ||.|:    |||   |       ...|:.:::|...|.:||.:..|.:||::.| ||.|:.|.|.
  Fly     4 LAYVIITIQLFGGLQC-------QKLPAKVKKCHFGDGKCLVESANALLRDFPK-GIPEVDLKPF 60

  Fly    63 DPLHVKKFKIGRNPHSPVN---IDLSFHEMDIL-----GLHQGVAKRVSGFTRD-LSRSIELVME 118
            :.|.|:.:.:       ||   :..:::..:::     |........:.||.:| .:..||:..:
  Fly    61 NVLSVRDWLL-------VNDSQVGGAWYYFNLINQINYGFENTTITEIRGFDKDPTTTKIEIHGK 118

  Fly   119 VPEIGVRGPYSVDGRIL-ILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELD 182
            :|.:..:|.|...||:| .:.|...|.::......:....:|: ||...:::.|.::..:...:.
  Fly   119 IPRLVYKGDYVAKGRMLWFVDIHSQGTSESDFLNFQFVLTLKV-RVEYRNNKRYLKIYELVPNIR 182

  Fly   183 PSHVTYQLENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQL 247
            .......|:|.|...:||:..::.|.|.||.:.:|||:|||...|..:..|:.:.:|.|:|.:.|
  Fly   183 LDRWIMWLDNFFPDNEDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDL 247

  Fly   248 FV 249
            |:
  Fly   248 FL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 57/237 (24%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 57/237 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059730at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.