DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG10407

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster


Alignment Length:244 Identity:62/244 - (25%)
Similarity:118/244 - (48%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ASDFPSGIERC---AIMDEQCLEDRVNFVLRNYAKSGIKELGLIPLDPLHVKKFKIGRNP----- 76
            |...||.::.|   |...:.|:.:... .||.....||.||.:..::||.|.:.|:.::.     
  Fly    31 ADQLPSFLKVCHRNAPDLDTCVRESYE-ELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYL 94

  Fly    77 HSPV-NI---DLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVMEVPEIGVRGPYSV----DGR 133
            ||.. |:   .:|.|.::.|.|.....|.:            |.:..|::.:...||:    :|:
  Fly    95 HSVYRNVKVTGISKHTVNELRLEPSKLKFI------------LSLTFPKLHMESDYSIKVSREGK 147

  Fly   134 ILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQK 198
            |:::|:.|:|...:.|....:|.:: :.:..|.:...:.::..:||:.:.|.|...|:|||||.|
  Fly   148 IMMMPLLGDGHCKVDLVNITMRTEL-IGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDK 211

  Fly   199 DLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQL 247
            .|.:.|:..:|||||.:..|::|.:.:|...|.::.||::|.....:.|
  Fly   212 ALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDDL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 61/243 (25%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.