DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG10264

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster


Alignment Length:264 Identity:66/264 - (25%)
Similarity:126/264 - (47%) Gaps:34/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LALVL-LFG--CASTYGHAS-------------DFPSGIERCAIM---DEQCLEDRVNFVLRNYA 50
            ||:.| :||  |..|..|.:             :.||.::.|...   :::|............|
  Fly    10 LAVSLSVFGSICLITVTHGAYTREIVNDKLPLQERPSWLQTCKRSNPNEDKCFRQLFEGCFPALA 74

  Fly    51 KSGIKELGLIPLDPLHVKKFKIGRNPHSPVNIDLS--FHEMDILGLHQGVAKRVSGFTRDLSRS- 112
             :||.|:|:...:||::.:..:.:...   |:.||  |.::.|.|......:|.|   .||.|. 
  Fly    75 -AGIPEIGVKSFEPLNIDQVSVSKGSG---NLVLSGGFQDLVIRGPSNATVRRAS---LDLERRL 132

  Fly   113 IELVMEVPEIGVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNI 177
            :...:|:|.:.:|..|::.|.||:||:.|:|  |:.:....|...:..:...:.:.:|..|:::|
  Fly   133 LNFELELPRLRIRAKYNLKGNILLLPLVGSG--DVAMALKNVHTTVYTRISLRNETRTGDEIIHI 195

  Fly   178 ---KVELDPSHVTYQLENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIF 239
               ||..|...:...|:|||||.:.|:.::::.:|:|.|::..||:|.:......|...:.:.:|
  Fly   196 DEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLWNNVF 260

  Fly   240 GKLP 243
            .|:|
  Fly   261 SKMP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 58/245 (24%)
CG10264NP_650518.1 JHBP 42..270 CDD:214779 58/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.