DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG1124

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:243 Identity:52/243 - (21%)
Similarity:100/243 - (41%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SDFPSGIERCAIMDEQCLEDRVNFV--LRNYAKSGIKELGLIPLDPLHVKKFKIGRNPHSPVNID 83
            ::.|..|::|...|.:.::..:..:  |:.|..:||.::.|..::|..:....: :....|....
  Fly    19 AETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDTLAL-QLTEGPQGYK 82

  Fly    84 LSFHEMDILGLHQGVAKRVSGFTRDLSRSIE-----LVMEVPEIGVRGPYSVDGRILILPITGNG 143
            ::...|:..|     |......:..||...|     :||  |::.:...|:..|.:||||.:|.|
  Fly    83 ITLKNMEAFG-----ASNFKVTSLKLSEGSEPFKAKIVM--PKLKIEAKYTSSGVLLILPASGGG 140

  Fly   144 IADIRLTRTKVRAQIKLK---RVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQKDLSENMH 205
              |.......|.|.:..|   ...||  ..|..:..:.:.||...|...:...||..:.|.|..:
  Fly   141 --DFHANFEGVSADLTGKTSIHAFKG--ANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEATN 201

  Fly   206 ALINENWKDIFN----ELKPGIGEAFGLIAKSVVDRIFGKLPLEQLFV 249
            ..:.||.:.:..    :|:..:...||.:|..::..:    |:||.:|
  Fly   202 LFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNV----PVEQFYV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 51/241 (21%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 51/240 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.