DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG14661

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:257 Identity:75/257 - (29%)
Similarity:117/257 - (45%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MELTLALVLLFGCASTYGHASDFPSGIERCAIMD---EQCLEDRVNFVLRNYAKSGIKELGLIPL 62
            |:..|.:..|..|......|.:.|..|:.|...|   .:||:..|: .||.|...|||||.:.||
  Fly     1 MQFQLIVASLLICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVH-NLRPYLAKGIKELNVPPL 64

  Fly    63 DPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVMEVPEIGVRGP 127
            :||::....|   ......:.:...:::|||.......::...|::.....||::  |.:...|.
  Fly    65 EPLYIGDLSI---LDGSAGLTVKAKKLNILGASNFEITKLRASTQNRRFDFELIL--PHLHGDGL 124

  Fly   128 YSVDGRILILPITGNGIADIRLTR--TKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQL 190
            |.::|.||.|||.|||......|.  ..||.|..:|.|:..:   |..|....:::.......:|
  Fly   125 YEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLE---YLHVKEFVLKIRTGKGNLKL 186

  Fly   191 ENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVV--DRIFGKLPLEQLFVV 250
            ||||||.|.|.:.::..||:|::...|:|...|..|  |.||.:|  .:|.......:||.|
  Fly   187 ENLFNGDKVLGDVINDTINQNFEVFTNDLIAPIARA--LEAKFLVITTKILENFTYSELFPV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 68/234 (29%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.