DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG31207

DIOPT Version :9

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:252 Identity:66/252 - (26%)
Similarity:129/252 - (51%) Gaps:16/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LALVLLFGCASTYGHASDFPSGIERCAIMDEQCLEDRVNFVLRNYAKSGIKELGLIPLDPLHVKK 69
            :.||||....|..|..  .|..|::|...|.:|:.:.:|.:::||.| ||..:||.|:|.:.::.
  Fly     6 IVLVLLQIIGSLQGQI--LPKEIKKCRFGDSKCIVNSMNAIIKNYPK-GIPAIGLKPIDVVDIRD 67

  Fly    70 FKIGRNPHSP---VNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRS-IELVMEVPEIGVRGPYSV 130
            .|...:....   :|.|| |:::: .|.......:||||..:.:.| ||:...:|.:..:|.|..
  Fly    68 SKFWNDAMVGAFWLNFDL-FNQVN-YGFENTTITKVSGFDENPTSSLIEIHGRIPSLIHKGDYFS 130

  Fly   131 DGRILILPI--TGNGIADIRLTRTKVRAQIKLKRVSK-GDHQTYAEVMNIKVELDPSHVTYQLEN 192
            .||:.|:.:  ||..::|.:    ..|..:|||.:.: .:::.|.::..:...:......:.|:|
  Fly   131 MGRVWIVQMNSTGESLSDFQ----NFRFVLKLKVIMEYRNNKRYLKIYELTPFVTMDRWVFWLDN 191

  Fly   193 LFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQLFV 249
            .|....|::..::.:.|.:|.:.:|||:|...:.|..:.:||.:.||.|:|.:.:|:
  Fly   192 FFESNTDMTIAINQVFNLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVPYDDMFL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 59/234 (25%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 65/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059730at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.