DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment to and CG14259

DIOPT Version :9

Sequence 1:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:266 Identity:69/266 - (25%)
Similarity:118/266 - (44%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLCL--------LVSVDAKFPEDP---KPCK-YGDG--EC----IMKLCNTLFSENSAEGDPGL- 54
            :|||        |||..|.:.|.|   ..|: |..|  :|    |.||.:.|     ..|.|.: 
  Fly    20 ILCLNEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQL-----NIGIPEVL 79

  Fly    55 -NLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYG-----IKDQRIVKVKGFGRDLTAKHEV 113
             .....||::|..:|..| :::....|....||.::.|     :|:.|:.| |.|      ..:.
  Fly    80 ERFGPFDPMRVRDIVFKQ-DNNEVATIRANLTDLVVKGFANTKVKESRVSK-KDF------SWQT 136

  Fly   114 KIVTKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITM 178
            ||......|.|.|.:.|::|::|:||:|:..:.:.::..::....:...|.|.|:.:||.:::.:
  Fly   137 KIYLPKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQL 201

  Fly   179 KPESSHYHFSNLFNG-DKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYA 242
            .......:..||||| .|.:..:.|.|.|||....|:.....|..:...:...|:..||..:| |
  Fly   202 NLSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIP-A 265

  Fly   243 KFFADE 248
            .||.::
  Fly   266 NFFVED 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toNP_001287525.1 JHBP 5..245 CDD:284096 67/261 (26%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 65/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.