DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment to and CG14258

DIOPT Version :9

Sequence 1:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:110/262 - (41%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AVVLCLLVSVD-AKF----PEDPKPCKYGD---GECIMKLCNTLFSENSAEGDPGLNLM-QLDPL 62
            ::|..||.:|: ||:    |:...||..||   ..|:.|...:.|.: ..:|.||.|.: ..||.
  Fly    10 SIVAVLLSAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQ-WKDGIPGYNAVGSFDPF 73

  Fly    63 KVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDL-----------TAKHEVKIV 116
            .:.|:..:| ::|..:.|.           .|.:.|.|.|.|:.|           .|:..:.:.
  Fly    74 YIKRVKFTQ-DASRSIAIN-----------ADLKEVYVAGAGQALVLESSWDPNHYVARTLISVP 126

  Fly   117 TKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKP- 180
            ...|:.  .|.::|.|..|.::|.|:......|...::..:.|||..:...:.||..:|:..:. 
  Fly   127 KLRFNF--DYKVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQSVKVNFREI 189

  Fly   181 ESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 245
            :.......|||.|:|.|.|..::..|||....::....|::::.|.:.|...|..|..:|.....
  Fly   190 KQFRIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYVPATYLI 254

  Fly   246 AD 247
            .|
  Fly   255 KD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toNP_001287525.1 JHBP 5..245 CDD:284096 61/258 (24%)
CG14258NP_651531.1 JHBP 13..255 CDD:284096 60/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.