DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment to and CG11852

DIOPT Version :9

Sequence 1:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster


Alignment Length:253 Identity:79/253 - (31%)
Similarity:127/253 - (50%) Gaps:12/253 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFAIAFAVVLCLLVSVDAKFPEDPKPCKYGDGECIMKLCNTLFSENSAEGDPGLNLMQLDPLKVD 65
            :..:....:.|.|||..:.||.:...|..||..||:.:.:.|..:::..|.|.....|::|..:.
  Fly     3 LLQLGCVALFCCLVSGASNFPPELPRCHMGDTSCIINVSHMLIRQHARTGYPSAGFPQVEPFLIK 67

  Fly    66 RMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRD-LTAKHEV-----KIVTKTFSLVG 124
            |..||.|.:.| :.:.|.|.|..:.|:...:..:..|||.| .|:|.|:     |||.|     |
  Fly    68 RFDISDGRTGS-LNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMYGSFPKIVLK-----G 126

  Fly   125 PYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSN 189
            .|...|::|||||.|.|.:.:.:.|.:..|.|......:||.|||.|..||:.::|:..:....|
  Fly   127 KYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLEN 191

  Fly   190 LFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFAD 247
            |||||:|||.|:|.|||:|...::.|...:|..:..::...|:..:|.:..|...|.:
  Fly   192 LFNGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLFLE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toNP_001287525.1 JHBP 5..245 CDD:284096 78/245 (32%)
CG11852NP_651357.1 JHBP 9..248 CDD:284096 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101599at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.