DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment to and CG13618

DIOPT Version :9

Sequence 1:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster


Alignment Length:255 Identity:74/255 - (29%)
Similarity:131/255 - (51%) Gaps:23/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFAIAFAVVLCLLVSVDAKFPEDPKPCKYGDG--ECIMKLCNTLFSENSAEGDPGLNLMQLDPLK 63
            |..:..||...|.|:...:.||....||....  :|::...|....:..| |:....:..|:||.
  Fly     9 MLLLIAAVAQELTVTAAQELPEGFPKCKRDANFDKCLVDAVNVAIQQLKA-GNREFGIPPLEPLT 72

  Fly    64 VDRMVISQGESSSPVGITLTFTDNLLYGIKDQRI------VKVKGFGRDLTAKHEVKIVTKT--F 120
            |.::||..|  ::|:        ||...:|:.::      .|::.:..||. ||.:...::|  .
  Fly    73 VKKLVIDAG--NAPI--------NLRQALKNVKVHDMISTSKIQRYRTDLD-KHLIICDSRTDRI 126

  Fly   121 SLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHY 185
            .::|.|.:.|::|:|||:|.|::|:|::|.:......|:|..|:|..|:.:.|.:::..|:..:.
  Fly   127 EMIGDYEMSGRILLLPITGHGKANVTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYM 191

  Fly   186 HFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 245
            :|.|||| ||.|.|.||.|||||.|.::.|......:|||.::..:...:|.|:|:...|
  Fly   192 NFENLFN-DKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toNP_001287525.1 JHBP 5..245 CDD:284096 72/249 (29%)
CG13618NP_651265.1 JHBP 13..251 CDD:284096 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470350
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.