DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment to and CG7079

DIOPT Version :9

Sequence 1:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:234 Identity:58/234 - (24%)
Similarity:110/234 - (47%) Gaps:13/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KFPEDPKPCKYGDGECIMKLCNTLFSENSAEGDPGLNLMQLDPLKV-DRMVISQGESSSPVG--- 79
            |.|...|.|.:|||:|:::..|.|. .:..:|.|.::|...:.|.| |.:::    :.|.||   
  Fly    21 KLPAKVKKCHFGDGKCLVESANALL-RDFPKGIPEVDLKPFNVLSVRDWLLV----NDSQVGGAW 80

  Fly    80 ITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTFSLV--GPYNIQGKVL-ILPISGTG 141
            ......:.:.||.::..|.:::||.:|.|.. :::|..|...||  |.|..:|::| .:.|...|
  Fly    81 YYFNLINQINYGFENTTITEIRGFDKDPTTT-KIEIHGKIPRLVYKGDYVAKGRMLWFVDIHSQG 144

  Fly   142 QSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKALGDNMNVFLN 206
            .|....:|.:.:::...:...:|.:.||.:.:|...::.:.......|.|..::.|...:|...|
  Fly   145 TSESDFLNFQFVLTLKVRVEYRNNKRYLKIYELVPNIRLDRWIMWLDNFFPDNEDLTIAVNNLFN 209

  Fly   207 ENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 245
            .|....:.|....|.|.|..::|.:.:.:|.|:||...|
  Fly   210 RNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toNP_001287525.1 JHBP 5..245 CDD:284096 57/232 (25%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 58/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059730at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.