DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment to and CG14661

DIOPT Version :9

Sequence 1:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:246 Identity:59/246 - (23%)
Similarity:104/246 - (42%) Gaps:11/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAFAVVLCLLVSVDA-KFPEDPKPCKYGDGE---CIMKLCNTLFSENSAEGDPGLNLMQLDPLKV 64
            |..::::|.:..:.| ..|:..:.|...|.|   |:....:.| ....|:|...||:..|:||.:
  Fly     6 IVASLLICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNL-RPYLAKGIKELNVPPLEPLYI 69

  Fly    65 DRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTFSLVGPYNIQ 129
            ..:.|..|.:    |:|:......:.|..:..|.|::...::  .:.:.:::.......|.|.|.
  Fly    70 GDLSILDGSA----GLTVKAKKLNILGASNFEITKLRASTQN--RRFDFELILPHLHGDGLYEIN 128

  Fly   130 GKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGD 194
            |.:|.|||.|.|.......|..|.|.........|...||.|.:..:.::....:....||||||
  Fly   129 GNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLENLFNGD 193

  Fly   195 KALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 245
            |.|||.:|..:|:|.|....:....|.|:....:|.:...:.....|::.|
  Fly   194 KVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toNP_001287525.1 JHBP 5..245 CDD:284096 57/243 (23%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 58/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470412
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.