DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment to and CG14457

DIOPT Version :9

Sequence 1:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster


Alignment Length:262 Identity:72/262 - (27%)
Similarity:129/262 - (49%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLLVSVDAKFPEDP---KPCKYGDGECIMKLCNT-----LFSENSAEGDPGL-NLMQLDPLKVDR 66
            ||:.:.|....|.|   |.|:..|.:.:.  |:|     ||.:.: :|.||| ::...||..::|
  Fly    16 CLVRAEDGFLKEPPDYIKECRIADKDFVN--CSTHSIQQLFDKLN-DGIPGLTSIRSFDPFYLNR 77

  Fly    67 MVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTFS---------- 121
            :.|:||.|:: :.:.:...:           ||:.|||.  |...:.::..|.:|          
  Fly    78 IRITQGNSNA-INLKVELAN-----------VKIIGFGH--TNVLDSQVFKKDYSWKTTFTLPEM 128

  Fly   122 -LVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHY 185
             |...|::.|::|::|::|.||..:...|:...:....:...|.|.|:.:||:|.:..|.:....
  Fly   129 KLQADYSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKS 193

  Fly   186 HFSNLFNGDKALGDNMNVFLNEN----SEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFA 246
            :|||||||:|.|.|:.|.|.|:|    ::|:|....:.|:    .:.|.|:|.:|..:| |.||.
  Fly   194 YFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIE----DILLDVLKKIFHFIP-ANFFV 253

  Fly   247 DE 248
            .:
  Fly   254 SD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toNP_001287525.1 JHBP 5..245 CDD:284096 70/257 (27%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 71/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470369
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.