DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment to and CG16820

DIOPT Version :9

Sequence 1:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:286 Identity:60/286 - (20%)
Similarity:101/286 - (35%) Gaps:91/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FAIAFAVVLCLLVSVDAKFPEDPKPCKYGD---GECIMKLCNTLFSENSAEGDPGLNLMQLDPLK 63
            ||:|.|.|..      :....:..||....   .|||..|..:...:...:|.|..|:..:||..
  Fly    69 FAVAPASVTL------SSGSNEVTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSIDPYF 127

  Fly    64 VDRMV---------------------ISQGESSSPVGITLTFTDN---LLYGIKDQRIVKVKGFG 104
            ..|.:                     |||.:.:|   :...||||   :..|::   :.::|..|
  Fly   128 YKRGIFRYTNDGIQGGLLIKNMEIYGISQLQVNS---VAANFTDNGFIIKLGVE---LPQLKAGG 186

  Fly   105 RDLTAKHEVK-----IVTKTFSLVGPYNI-----------QGKVLILPISGTGQSNMTMVNVRAI 153
            .   .|.:||     :|.|     ||:||           .|.:..||   :||..:::..:.|.
  Fly   187 H---FKADVKFGGLRLVPK-----GPFNITIDNIKATILTDGHIEQLP---SGQQRLSLHRLNAN 240

  Fly   154 VSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAK 218
            |:.....:|.||                        :|: |:.|...:...:|||...|.:....
  Fly   241 VNIGDAKVVANG------------------------IFS-DRNLNAMILNLVNENLPEITRVGIP 280

  Fly   219 AIDRSFGKLYLGVVKGVFSKLPYAKF 244
            |....:..:.:..:...|:|:|..||
  Fly   281 ATREQWAPILIAHINEFFAKVPIEKF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toNP_001287525.1 JHBP 5..245 CDD:284096 58/283 (20%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 55/270 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.