DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment to and CG3246

DIOPT Version :9

Sequence 1:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:245 Identity:54/245 - (22%)
Similarity:80/245 - (32%) Gaps:74/245 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FSENSAEGDPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVK------ 101
            |.:...:|.||:.:.  |||:|..:..|.|.::      |.......||:...||.|:.      
  Fly    60 FQQEDPQGLPGVPVP--DPLEVPNVKKSMGMAN------LDMKQVKAYGLSKFRIDKMNLDLKEM 116

  Fly   102 ----GFGRD-LTAKHEVKIVTKTFSLVGPYNIQGK------VLILPISGTGQ------------S 143
                |...| :..|.:..:.:......||:.:..|      ...|.:...||            |
  Fly   117 RFNGGLQLDQMLVKGQYTLSSFFSKANGPFTVVLKNVYAEATAFLAVERDGQLATDRIKIDITFS 181

  Fly   144 NMTMVNVRAIVSFSGKPLVKNGETYLDVTD-----LKITMKPESSHYHFSNLFNGDKALGDNMNV 203
            :|||       .|....||  |..:..|.:     :...|||       ..|...||.|...:||
  Fly   182 DMTM-------DFQNLGLV--GSVFQSVVNGAPNLVFDAMKP-------FMLQEADKKLRSEINV 230

  Fly   204 FLNE--------NS-----EAIYKETAKAIDRSFGKLYLGVVK---GVFS 237
            .:.:        ||     .||.........:.|...:|..|.   ||||
  Fly   231 MIQKTLGERRLPNSITPLDSAIAMARKMVRQKGFDPYHLPDVNRTMGVFS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
toNP_001287525.1 JHBP 5..245 CDD:284096 54/245 (22%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 45/209 (22%)
Grp7_allergen 260..418 CDD:293589 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.