DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG17189

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:273 Identity:70/273 - (25%)
Similarity:121/273 - (44%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLLQLG-----CVALFC---CLVSGASNFPPELPRCHMGDTSCIINVSHMLIRQHARTGYP--S 55
            :|||..|     |||.:.   ..:.....:.||..:|........:|   .|::     |.|  .
  Fly     7 LMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMN---QLVK-----GVPEIE 63

  Fly    56 AGFPQVEPF----LIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSK---- 112
            ..|..::|.    |:.:.|.||..|    |..|..|:.:.|...:..       .:...||    
  Fly    64 ESFGPIDPMRQEQLVFKQDNSDVAT----LSANLTDMLIRGFGKMLI-------KESKVSKKDFS 117

  Fly   113 --FEMYGSFPKIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDK 175
              .::|  .|::.:.|.|...||||::|::|:|...:.:.:....:..|....::.|.|:.:|..
  Fly   118 WLTKIY--LPQMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTS 180

  Fly   176 LKVLVEPQKMNIRLENLFNG-DQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFK 239
            :||.|:..|:..||:||||| .:.:..:.|||.||||.:|:..|.|   :.:..:.:::|..|.|
  Fly   181 VKVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRP---LVVETVERTLLDLLHK 242

  Fly   240 RFAY--EDLFLEN 250
            .||.  ...|:|:
  Fly   243 TFALFPASFFVED 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 63/256 (25%)
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.