DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG14259

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:272 Identity:68/272 - (25%)
Similarity:117/272 - (43%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GCVALFC--------CLVSGASNF---PPELPRCHM---GDTSCIINVSHMLIRQHARTGYPSAG 57
            |.:|:.|        .|||..:.:   |..||.|.:   |.|.|..|....|:.|      .:.|
  Fly    16 GLLAILCLNEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQ------LNIG 74

  Fly    58 FPQV-------EPFLIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSK--- 112
            .|:|       :|..::.............::.|..|:.|:|.::.|.       .:...||   
  Fly    75 IPEVLERFGPFDPMRVRDIVFKQDNNEVATIRANLTDLVVKGFANTKV-------KESRVSKKDF 132

  Fly   113 ---FEMYGSFPKIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVD 174
               .::|  .||:.|.|:|...||||::|:.|.|...|.:.:....:..|....::.|.|:.:|.
  Fly   133 SWQTKIY--LPKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVT 195

  Fly   175 KLKVLVEPQKMNIRLENLFNG-DQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLF 238
            .::|.:...|:...|:||||| .:.:..:.|:|.|:||.:.:..|.|.|...:..|:..|:|.:|
  Fly   196 AVQVQLNLSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVF 260

  Fly   239 ----KRFAYEDL 246
                ..|..||:
  Fly   261 HLIPANFFVEDI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 67/270 (25%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470355
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.