DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG14258

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster


Alignment Length:255 Identity:60/255 - (23%)
Similarity:100/255 - (39%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MLLQ----LGCVALFCCLVSGA---SNFPPELPRCHMGDTS---CIINVSHMLIRQ--HARTGYP 54
            ||::    |..||:....|.||   :..|..|..|.:||.:   |:........||  ....||.
  Fly     1 MLIKVAKFLSIVAVLLSAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGYN 65

  Fly    55 SAGFPQVEPFLIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMYGSF 119
            :.|  ..:||.|||...:...:.|:.:..:.::|.|.|....   ..:....||.........|.
  Fly    66 AVG--SFDPFYIKRVKFTQDASRSIAINADLKEVYVAGAGQA---LVLESSWDPNHYVARTLISV 125

  Fly   120 PKIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKV-LVEPQ 183
            ||:.....|...|.:..|.:.|.|.......|....::........:...:..|..:|| ..|.:
  Fly   126 PKLRFNFDYKVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGYFADVQSVKVNFREIK 190

  Fly   184 KMNIRLENLFNGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAY 243
            :..|:|||||.|::.|....:...|:||.:.:..|.|::...:..::   |.:..|.|.|
  Fly   191 QFRIKLENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVL---LDRFKKTFVY 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 57/244 (23%)
CG14258NP_651531.1 JHBP 13..255 CDD:284096 56/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.