DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG11854

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster


Alignment Length:250 Identity:86/250 - (34%)
Similarity:137/250 - (54%) Gaps:4/250 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MLLQLGCVALFCC--LVSGASNFPPELPRCHMGDTSCIINVSHMLIRQHARTGYPSAGFPQVEPF 64
            |.|.|..|.||.|  ....||:||..:.||.:.|..|:.:..:.::|.:|::|....|...::|.
  Fly     1 MELTLALVLLFGCASTYGHASDFPSGIERCAIMDEQCLEDRVNFVLRNYAKSGIKELGLIPLDPL 65

  Fly    65 LIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMYGSFPKIVLKGKYV 129
            .:|:|.|.......:|:.|:|.::::.||......|..||..|.:.| .|:....|:|.::|.|.
  Fly    66 HVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRS-IELVMEVPEIGVRGPYS 129

  Fly   130 ADGRILILPIRGDGDAEIVLHNPKFSVKFK-PGTQQRNGRTYLSVDKLKVLVEPQKMNIRLENLF 193
            .|||||||||.|:|.|:|.|...|...:.| ....:.:.:||..|..:||.::|..:..:|||||
  Fly   130 VDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLF 194

  Fly   194 NGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLFL 248
            ||.:.|..|::..:|:||.:::|||.|.|..|...|.|||:.::|.:...|.||:
  Fly   195 NGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQLFV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 82/241 (34%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 77/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101599at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.