DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG13618

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster


Alignment Length:262 Identity:71/262 - (27%)
Similarity:124/262 - (47%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLLQLGCVALFCCLVSGASNFPPELPRCHMGDT--SCIINVSHMLIRQHARTGYPSAGFPQVEP 63
            :|||.:..||.. ..|:.|...|...|:|.....  .|:::..::.|:| .:.|....|.|.:||
  Fly     8 LMLLLIAAVAQE-LTVTAAQELPEGFPKCKRDANFDKCLVDAVNVAIQQ-LKAGNREFGIPPLEP 70

  Fly    64 FLIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMY------------ 116
            ..:|:. :.|.....:||:...::|.|..:.|              |||.:.|            
  Fly    71 LTVKKL-VIDAGNAPINLRQALKNVKVHDMIS--------------TSKIQRYRTDLDKHLIICD 120

  Fly   117 GSFPKIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVE 181
            ....:|.:.|.|...||||:|||.|.|.|.:.|.|.|...:......:::|..|:.:...:|..:
  Fly   121 SRTDRIEMIGDYEMSGRILLLPITGHGKANVTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFD 185

  Fly   182 PQKMNIRLENLFNGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDL 246
            |:::.:..||||| |:.|...:|:|||:||..|:|||......:...|.:.:.::||::..::::
  Fly   186 PKRVYMNFENLFN-DKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNI 249

  Fly   247 FL 248
            ||
  Fly   250 FL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 66/252 (26%)
CG13618NP_651265.1 JHBP 13..251 CDD:284096 66/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.