DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG15497

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster


Alignment Length:261 Identity:57/261 - (21%)
Similarity:104/261 - (39%) Gaps:35/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MLLQLGCVALFCCLVSGAS-------NFPPELPRCHMGD---TSCIINVSHMLIRQHARTGYPSA 56
            :|:.|..::||...::.||       :....|.|||..|   ..|:..|.:.| |.:..||.|..
  Fly    12 LLVYLAGISLFANHLANASSQIDVDTDLKHLLGRCHWSDEDFNECMRQVFNDL-RAYFTTGVPDY 75

  Fly    57 GFPQVEPFLIKRFDISDGRTGSL-NLKLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMYGSFP 120
            .....:|......::..|.:..| :.:|..|:|:..|.:..:..:   |.|||...:......||
  Fly    76 NIKPFDPHHCSYVELRRGESQGLGSFRLILRNVSEYGWARSEVTK---FHADPEDQRIVYTQYFP 137

  Fly   121 KIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFK----PGTQQRNGRTYLSVDKLKVLVE 181
            ...|:|:|....::|...:...|...:.|::...:...:    ||:            .:||.||
  Fly   138 DKSLEGEYEFAAKMLGTEMNRKGHWNLTLYDYSQTTSVRRIGGPGS------------LIKVHVE 190

  Fly   182 PQK---MNIRLENLFNGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAY 243
            ..:   |.:.:|||..| |.|....:..:|..|......:.|.|:..::.....:.::.|:.|..
  Fly   191 VDRIGGMELHIENLLQG-QPLNQLADGVINSMWQLGLPFIKPMINELVSTAFTDIFNESFRHFPL 254

  Fly   244 E 244
            |
  Fly   255 E 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 55/254 (22%)
CG15497NP_650976.1 JHBP 26..258 CDD:284096 53/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.