DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG17279

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:248 Identity:72/248 - (29%)
Similarity:120/248 - (48%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VALFCCLVSGAS--NFPPELPRCHMGDTSCIINVSHMLIRQHARTGYPSAGFPQV-----EPFLI 66
            :...|||....|  ..|||:.:|..||:.||......::|.:.: |.||.|...:     |..::
  Fly     4 IVFVCCLWMAPSLGQLPPEIEKCRAGDSICIAETVTRILRLYPK-GLPSIGLVALDSIGFEDVVV 67

  Fly    67 KRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFGAD-PATSKFEMYGSFPKIVLKGKYVA 130
            .|.:    ..||....|.|.::.|.|.:......|.||.|| |..  .|:.|..|.:.|.|.|..
  Fly    68 SRLE----PDGSSTFDLKFPNLTVIGFADSTVTEAKGFDADLPRV--LELSGWIPLLKLNGTYEM 126

  Fly   131 DGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQR-NGRTYLSVDKLKVLVEPQKMNIRLENLFN 194
            .|.:|.:||.|.|.|::.:...:...|.:.....| :|:.|..:.|:|.|::.|.|::.||||||
  Fly   127 RGSLLTMPIHGKGQAKVEIRECRVRCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFN 191

  Fly   195 GDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLF 247
            ..: :...:|...|..|.|:|:.|...|..|:.::::|:|.::..:..|:||:
  Fly   192 NPE-MSDAMNVVANTKWLEIWHNLRRGITSAVDQLVESILQRVANKLPYDDLY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 72/248 (29%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101599at6656
OrthoFinder 1 1.000 - - FOG0012701
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.