DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG31189

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster


Alignment Length:243 Identity:61/243 - (25%)
Similarity:114/243 - (46%) Gaps:8/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FCC-----LVSGASNFPPELPRCHMGDTSCIINVSHMLIRQHARTGYPSAGFPQVEPFLIKRFDI 71
            |.|     ::|||| .|.::.:||.||::|::...:.||: |...|.|..|.|.::.:......|
  Fly     9 FLCWCIPVMISGAS-LPEDVEKCHFGDSTCLVRSINALIK-HYPKGIPEIGLPPLDAYNFPDSVI 71

  Fly    72 SDGRT-GSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMYGSFPKIVLKGKYVADGRIL 135
            .:..: |.:.:....||...:|.::.......||..:|...:..:....|::|.:..|...||:|
  Fly    72 MESPSRGPIWMDFRMRDNVNKGFNNATITHVEGFLYEPNQKQIVLKVRLPRLVHEATYDMSGRVL 136

  Fly   136 ILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLENLFNGDQALG 200
            :......|.......|.:.::..|...:.||.:.||.:..|...::..:..|.|:.|:..:..:.
  Fly   137 LFFFNTTGRLISDFQNFRITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLYKENTDVT 201

  Fly   201 TNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLFL 248
            ..:|:..|:||.|.||:|.|.:..|.......:|:::|...||:|:||
  Fly   202 IFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMFL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 59/241 (24%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 59/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470335
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012701
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.