DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG10264

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster


Alignment Length:191 Identity:60/191 - (31%)
Similarity:98/191 - (51%) Gaps:6/191 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GYPSAGFPQVEPFLIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMY 116
            |.|..|....||..|.:..:|.| :|:|.|...|:|:.:.|.|:....|| ....:.....||: 
  Fly    76 GIPEIGVKSFEPLNIDQVSVSKG-SGNLVLSGGFQDLVIRGPSNATVRRA-SLDLERRLLNFEL- 137

  Fly   117 GSFPKIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFSV--KFKPGTQQRNGRTYLSVDKLKVL 179
             ..|::.::.||...|.||:||:.|.||..:.|.|...:|  :.....:.|.|...:.:|::||.
  Fly   138 -ELPRLRIRAKYNLKGNILLLPLVGSGDVAMALKNVHTTVYTRISLRNETRTGDEIIHIDEMKVG 201

  Fly   180 VEPQKMNIRLENLFNGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKR 240
            .:...|.|.|:|||||::.|..::|.|||.|..||..||.|.:.:.:|:|...:.:.:|.:
  Fly   202 FDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELGLADIFHGLWNNVFSK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 60/191 (31%)
CG10264NP_650518.1 JHBP 42..270 CDD:214779 60/191 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470356
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.