DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG1124

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:234 Identity:56/234 - (23%)
Similarity:101/234 - (43%) Gaps:16/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PPELPRCHMGD---TSCIIN-VSHMLIRQHARTGYPSAGFPQVEPFLIK--RFDISDGRTGSLNL 81
            ||.:.:||..|   ..|.|. :.|  ::.:...|.|....|.||||.:.  ...:::|..|   .
  Fly    22 PPYIKQCHRNDPKLVDCFIGAIEH--LKPYLANGIPDIQLPSVEPFKMDTLALQLTEGPQG---Y 81

  Fly    82 KLNFRDVNVEGLSSVKF-DRAVGFGADPATSKFEMYGSFPKIVLKGKYVADGRILILPIRGDGDA 145
            |:..:::...|.|:.|. ...:..|::|..:|..|    ||:.::.||.:.|.:||||..|.||.
  Fly    82 KITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIVM----PKLKIEAKYTSSGVLLILPASGGGDF 142

  Fly   146 EIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLENLFNGDQALGTNLNQFLNDN 210
            ..........:..|.......|..||.:|.|.::::.:.:.:.:...||.::.|....|.||.:|
  Fly   143 HANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEATNLFLREN 207

  Fly   211 WTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLFLE 249
            ...|...:...:...:|.....:.:||.|....|..:::
  Fly   208 SQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFYVD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 56/231 (24%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 56/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.