DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG14457

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster


Alignment Length:246 Identity:65/246 - (26%)
Similarity:108/246 - (43%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VALFCCLVSGASNF---PPE-LPRCHMGDTSCIINVSHMLIRQ---HARTGYPS-AGFPQVEPFL 65
            |....|||.....|   ||: :..|.:.|.. .:|.|...|:|   ....|.|. ......:||.
  Fly    11 VTFTTCLVRAEDGFLKEPPDYIKECRIADKD-FVNCSTHSIQQLFDKLNDGIPGLTSIRSFDPFY 74

  Fly    66 IKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFG----ADPATSK----FEMYGSFPKI 122
            :.|..|:.|.:.::|||:...:|.:           :|||    .|....|    ::...:.|::
  Fly    75 LNRIRITQGNSNAINLKVELANVKI-----------IGFGHTNVLDSQVFKKDYSWKTTFTLPEM 128

  Fly   123 VLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNI 187
            .|:..|...||||::|:.|.|...:...|...::..|.....:.|.|:.:|..|.|..:...:..
  Fly   129 KLQADYSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKS 193

  Fly   188 RLENLFNGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLF 238
            ...|||||::.|..:.|:|.||||..:.:.|:..|...|.:|:..||.::|
  Fly   194 YFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 65/246 (26%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.