DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG16820

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:251 Identity:51/251 - (20%)
Similarity:99/251 - (39%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSGASNFPPELPRCHMGD---TSCIINVSHMLIRQHARTGYPSAGFPQVEPFLIKRFDI---SD 73
            |.||::...|    |.:..   ..||..:......:....|.|......::|:..||...   :|
  Fly    78 LSSGSNEVTP----CSLNSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSIDPYFYKRGIFRYTND 138

  Fly    74 GRTGSLNLKLNFRDVNVEGLSSVKFDR-AVGFGADPATSKFEMYGSFPKIVLKGKYVAD---GRI 134
            |..|.|.:|    ::.:.|:|.::.:. |..|..:....|..:  ..|::...|.:.||   |.:
  Fly   139 GIQGGLLIK----NMEIYGISQLQVNSVAANFTDNGFIIKLGV--ELPQLKAGGHFKADVKFGGL 197

  Fly   135 LILPIRGDGDAEIVLHNPKFS------VKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLENLF 193
            .::|   .|...|.:.|.|.:      ::..|..|||     ||:.:|...|......:....:|
  Fly   198 RLVP---KGPFNITIDNIKATILTDGHIEQLPSGQQR-----LSLHRLNANVNIGDAKVVANGIF 254

  Fly   194 NGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLFLE 249
            : |:.|...:...:|:|..|:.....|:.....|.|:.:.:::.|.:...|...::
  Fly   255 S-DRNLNAMILNLVNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIEKFLVQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 51/248 (21%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 50/247 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.