DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG3246

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:247 Identity:51/247 - (20%)
Similarity:89/247 - (36%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SCIINVSHMLI--RQHARTGYPSAGFPQVEPFLIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVK 97
            |....|..||:  :|....|.|  |.|..:|..:.....|.|..     .|:.:.|...|||..:
  Fly    48 SIAAQVEAMLVHFQQEDPQGLP--GVPVPDPLEVPNVKKSMGMA-----NLDMKQVKAYGLSKFR 105

  Fly    98 FDRAVGFGADPATSKFEMYGSFPKIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGT 162
            .|:   ...|....:|.......::::||:|......    .:.:|...:||.|     .:...|
  Fly   106 IDK---MNLDLKEMRFNGGLQLDQMLVKGQYTLSSFF----SKANGPFTVVLKN-----VYAEAT 158

  Fly   163 Q----QRNGRTYLSVDKLKVLVEPQKMNIRLENL----------FNG-----------------D 196
            .    :|:|:  |:.|::|:.:....|.:..:||          .||                 |
  Fly   159 AFLAVERDGQ--LATDRIKIDITFSDMTMDFQNLGLVGSVFQSVVNGAPNLVFDAMKPFMLQEAD 221

  Fly   197 QALGTNLNQFLNDNWTE--VWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDL 246
            :.|.:.:|..:.....|  :.|.:.| :..|||...|.|..:.|..:...|:
  Fly   222 KKLRSEINVMIQKTLGERRLPNSITP-LDSAIAMARKMVRQKGFDPYHLPDV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 51/247 (21%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 43/218 (20%)
Grp7_allergen 260..418 CDD:293589 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.