DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG31207

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:229 Identity:68/229 - (29%)
Similarity:116/229 - (50%) Gaps:6/229 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PPELPRCHMGDTSCIINVSHMLIRQHARTGYPSAGFPQVEPFLIKRFDI-SDGRTGS--LNLKLN 84
            |.|:.:|..||:.||:|..:.:|:.:.: |.|:.|...::...|:.... :|...|:  ||..| 
  Fly    23 PKEIKKCRFGDSKCIVNSMNAIIKNYPK-GIPAIGLKPIDVVDIRDSKFWNDAMVGAFWLNFDL- 85

  Fly    85 FRDVNVEGLSSVKFDRAVGFGADPATSKFEMYGSFPKIVLKGKYVADGRILILPIRGDGDAEIVL 149
            |..||. |..:....:..||..:|.:|..|::|..|.::.||.|.:.||:.|:.:...|::....
  Fly    86 FNQVNY-GFENTTITKVSGFDENPTSSLIEIHGRIPSLIHKGDYFSMGRVWIVQMNSTGESLSDF 149

  Fly   150 HNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLENLFNGDQALGTNLNQFLNDNWTEV 214
            .|.:|.:|.|...:.||.:.||.:.:|...|...:....|:|.|..:..:...:||..|.:|.|.
  Fly   150 QNFRFVLKLKVIMEYRNNKRYLKIYELTPFVTMDRWVFWLDNFFESNTDMTIAINQVFNLHWVEF 214

  Fly   215 WNELHPSIHVAIAEIMKSVLSQLFKRFAYEDLFL 248
            ||||.|:.....|.:.:||...:||:..|:|:||
  Fly   215 WNELEPTNLKIFAGVFRSVFEDIFKKVPYDDMFL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 66/227 (29%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 66/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059730at2759
OrthoFinder 1 1.000 - - FOG0012701
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.