DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sil1 and SIL1

DIOPT Version :9

Sequence 1:NP_651356.1 Gene:Sil1 / 43034 FlyBaseID:FBgn0039296 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_014611.1 Gene:SIL1 / 854126 SGDID:S000005391 Length:421 Species:Saccharomyces cerevisiae


Alignment Length:349 Identity:72/349 - (20%)
Similarity:135/349 - (38%) Gaps:95/349 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FVATDEWQTIAEGQAIPRGLHVRINLQTGLKEAKLLDESERGTS-----------LQSQPDDQNA 87
            |....:||.|..||.:|.||.:|||:.||||||||.||...|.:           :::.|.|...
Yeast    62 FEPRHDWQPILPGQELPGGLDIRINMDTGLKEAKLNDEKNVGDNGSHELIVSSEDMKASPGDYEF 126

  Fly    88 RESHDDNEPLALDYKPDIIEESIRRVKEQKKSYAELRKAYKEFQKNFRTDGELIVQLIDQFRNFS 152
            .....:...: :|..|.:..:.|.|:::......|....||...|       :|..         
Yeast   127 SSDFKEMRNI-IDSNPTLSSQDIARLEDSFDRIMEFAHDYKHGYK-------IITH--------- 174

  Fly   153 RTPLESEMRSKLDCLENLEYLLHQIDNALMFIDNGGLDDVLLPIVVNDTSTSLRVSAMRVLGSLA 217
                |..:.:.|...||                        ||:.:.:.||       ||:.|..
Yeast   175 ----EFALLANLSLNEN------------------------LPLTLRELST-------RVITSCL 204

  Fly   218 SNNPKAQIKVFEKNFGSHLAQILTSSGNVGE-----ISAALHAFGALLRKFPLAQQRVLSTSGTQ 277
            .|||.. ::...::|.:..::|:.:..|:.:     .:..:..:.::|.:.|:..:. |....|.
Yeast   205 RNNPPV-VEFINESFPNFKSKIMAALSNLNDSNHRSSNILIKRYLSILNELPVTSED-LPIYSTV 267

  Fly   278 ALIKVLQSPDVELRSKAKVVTLIS-------------DLVLEKRSVLDVSKDDPEASSTMAQYVL 329
            .|..|.:..:.:.:.:.||:.|||             :|:|.||:..:.|.:..|.::       
Yeast   268 VLQNVYERNNKDKQLQIKVLELISKILKADMYENDDTNLILFKRNAENWSSNLQEWAN------- 325

  Fly   330 LDFESWLKTPGYCAAVDTVLTKEF 353
             :|:..::.    .::|.:.|:.|
Yeast   326 -EFQEMVQN----KSIDELHTRTF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sil1NP_651356.1 SIL1 167..>326 CDD:374797 32/176 (18%)
SIL1NP_014611.1 SIL1 123..421 CDD:407047 48/288 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005609
OrthoInspector 1 1.000 - - oto99788
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19316
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R442
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.